PDB entry 2n0w

View 2n0w on RCSB PDB site
Description: Mdmx-SJ212
Class: signaling protein
Keywords: MDMX, negative regulators of p53, SIGNALING PROTEIN
Deposited on 2015-03-17, released 2016-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Mdm4
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n0wa_
  • Heterogens: 48L

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n0wA (A:)
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtlat