PDB entry 2n0m

View 2n0m on RCSB PDB site
Description: The solution structure of the soluble form of the Lipid-modified Azurin from Neisseria gonorrhoeae
Class: metal binding protein
Keywords: Neisseria, copper protein, azurin-family, metal binding protein, electron transfer
Deposited on 2015-03-10, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lipid modified azurin protein
  Species: Neisseria gonorrhoeae [TaxId:242231]
  Gene: NGO0994
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5F809 (2-129)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d2n0ma1, d2n0ma2
• Heterogens: CU1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n0mA (A:)
  atagncaatvesndnmqfntkdiqvskackeftitlkhtgtqpkasmghnlviakaedmd
  gvfkdgvgaadtdyvkpddarvvahtkligggeessltldpakladgdykfactfpghga
  lmngkvtlvd