PDB entry 2mzr

View 2mzr on RCSB PDB site
Description: NMR structure of the RRM1 domain of Hrb1
Class: RNA binding protein
Keywords: RRM, RNA binding domain, Hrb1, THO/TREX, RNA binding protein
Deposited on 2015-02-23, released 2015-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein HRB1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HRB1, N2009, TOM34, YNL004W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38922 (2-94)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2mzra1, d2mzra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mzrA (A:)
    gsareldstyeekvnrnysnsifvgnltydstpedlteffsqigkvvradiitsrghhrg
    mgtveftnsddvdrairqydgaffmdrkifvrqdn