PDB entry 2mzq

View 2mzq on RCSB PDB site
Description: NMR structure of the RRM3 domain of Gbp2
Class: RNA binding protein
Keywords: RRM, RNA binding domain, Gbp2, THO/TREX, RNA binding protein
Deposited on 2015-02-23, released 2015-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand telomeric DNA-binding protein GBP2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GBP2, RLF6, YCL011C, YCL11C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25555 (2-100)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2mzqa1, d2mzqa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mzqA (A:)
    gshidetaakftegvnpggdrncfiycsnlpfstarsdlfdlfgpigkinnaelkpqeng
    qptgvavveyenlvdadfciqklnnynyggcslqisyarrd