PDB entry 2mzd

View 2mzd on RCSB PDB site
Description: Characterization of the p300 Taz2-p53 TAD2 Complex and Comparison with the p300 Taz2-p53 TAD1 Complex
Class: protein binding
Keywords: protein binding
Deposited on 2015-02-11, released 2015-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (0-89)
      • engineered mutation (15)
      • engineered mutation (23)
      • engineered mutation (66-67)
    Domains in SCOPe 2.08: d2mzda_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mzdA (A:)
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqk

  • Chain 'B':
    No sequence available.