PDB entry 2myy

View 2myy on RCSB PDB site
Description: Solution structure of an MbtH-like protein from Mycobacterium marinum, Seattle Structural Genomics Center for Infectious Disease target MymaA.01649.c
Class: structural genomics, unknown function
Keywords: infectious diseases, tuberculosis, siderophore assembly, mycobactin, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2015-02-02, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical MbtH-like protein
    Species: Mycobacterium marinum M [TaxId:216594]
    Gene: B2HHJ4, MMAR_3265
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2HHJ4 (4-79)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2myya1, d2myya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2myyA (A:)
    gpgsmkimsdnpfddedgmffvlindeeqhslwptfadvpagwrvvfgeasrascveyvd
    qhwtdirpkslreklasgqg