PDB entry 2mys

View 2mys on RCSB PDB site
Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains
Class: muscle protein
Keywords: muscle protein, myosin subfragment-1, myosin head, motor protein
Deposited on 1996-06-27, released 1997-01-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13538 (Start-842)
      • modified residue (18)
      • modified residue (29)
      • modified residue (34)
      • conflict (44)
      • modified residue (48)
      • modified residue (54)
      • modified residue (58)
      • modified residue (62)
      • modified residue (83)
      • modified residue (86)
      • modified residue (106)
      • modified residue (129)
      • conflict (137)
      • modified residue (189)
      • modified residue (235)
      • modified residue (247)
      • modified residue (271)
      • modified residue (294-295)
      • conflict (316)
      • modified residue (347)
      • modified residue (352)
      • modified residue (366)
      • modified residue (368)
      • modified residue (384)
      • conflict (406)
      • conflict (411)
      • modified residue (414)
      • conflict (416)
      • conflict (420)
      • modified residue (430)
      • modified residue (435)
      • modified residue (485)
      • modified residue (503-504)
      • modified residue (527)
      • modified residue (550)
      • modified residue (552)
      • conflict (556)
      • modified residue (597)
      • modified residue (599)
      • modified residue (612)
      • modified residue (616)
      • modified residue (658)
      • modified residue (680)
      • conflict (749-750)
      • conflict (758)
      • modified residue (763)
      • modified residue (767)
      • modified residue (781)
      • conflict (788)
      • conflict (804)
      • modified residue (826)
      • modified residue (832)
      • modified residue (836)
      • modified residue (838)
    Domains in SCOPe 2.01: d2mysa1, d2mysa2
  • Chain 'B':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02609
      • conflict (20)
      • conflict (22)
      • conflict (24-25)
      • conflict (37)
      • conflict (123-125)
      • conflict (162)
    Domains in SCOPe 2.01: d2mysb_
  • Chain 'C':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02605 (Start-148)
      • conflict (4-6)
      • conflict (26)
      • conflict (33)
      • conflict (60-61)
    Domains in SCOPe 2.01: d2mysc_
  • Heterogens: MG, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mysA (A:)
    aspdaemaafgeaapylrksekerieaqnkpfdakssvfvvhpkqsfvkgtiqskeggkv
    tvkteggetltvkedqvfsmnppkydkiedmammthlhepavlynlkeryaawmiytysg
    lfcvtvnpykwlpvynpkvvlayrgkkrqeapphifsisdnayqfmltdrenqsilitge
    sgagktvntkrviqyfatiaasgekkkeeqsgkmqgtledqiisanplleafgnaktvrn
    dnssrfgkfirihfgatgklasadietylleksrvtfqlpaersyhifyqimsnkkpeli
    dmllittnpydyhyvsegeitvpsiddqeelmatdsaidilgfsadektaiykltgavmh
    ygnlkfkqkqreeqaepdgtevadkaaylmglnsaellkalcyprvgvgneavtkgetvs
    evhnsvgalakavyekmflwmvirinqqldtkqprqyfigvldiagfeifdfnsfeqlci
    nftneklqqffnhhmfvleqeeykkegiewefidfgmdlaacieliekpmgifsileeec
    mfpkatdtsfknklydehlgksnnfqkpkpakgkaeahfslvhyagtvdynisgwleknk
    dplnetviglyqkssvktlallfatyggeaeggggkkggkkkgssfqtvsalfrenlnkl
    manlrsthphfvrciipnetktpgamehelvlhqlrcngvlegiricrkgfpsrvlyadf
    kqryrvlnasaipegqfmdskkasekllgggdvdhtqyafghtkvffkagllglleemrd
    dklaeiitatqarcrgflmrveyramverresifciqynvrsfmnvkhwpwmklffkikp
    llk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mysA (A:)
    daemaafgeaapylrksekerieaqnkpfdakssvfvvhpkqsfvkgtiqskeggkvtvk
    teggetltvkedqvfsmnppkydkiedmammthlhepavlynlkeryaawmiytysglfc
    vtvnpykwlpvynpkvvlayrgkkrqeapphifsisdnayqfmltdrenqsilitgesga
    gktvntkrviqyfatiaasgegtledqiisanplleafgnaktvrndnssrfgkfirihf
    gatgklasadietylleksrvtfqlpaersyhifyqimsnkkpelidmllittnpydyhy
    vsegeitvpsiddqeelmatdsaidilgfsadektaiykltgavmhygnlkfkqkqreeq
    aepdgtevadkaaylmglnsaellkalcyprvgvgneavtkgetvsevhnsvgalakavy
    ekmflwmvirinqqldtkqprqyfigvldiagfeifdfnsfeqlcinftneklqqffnhh
    mfvleqeeykkegiewefidfgmdlaacieliekpmgifsileeecmfpkatdtsfknkl
    ydehlgksnnfqkpkpaaeahfslvhyagtvdynisgwleknkdplnetviglyqkssvk
    tlallfatyqtvsalfrenlnklmanlrsthphfvrciipnetktpgamehelvlhqlrc
    ngvlegiricrkgfpsrvlyadfkqryrvlnasamdskkasekllgggdvdhtqyafght
    kvffkagllglleemrddklaeiitatqarcrgflmrveyramverresifciqynvrsf
    mnvkhwpwmklffkikpllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2mysB (B:)
    pkkakrraaegssnvfsmfdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvk
    neeldamikeasgpinftvfltmfgeklkgadpedvimgafkvldpdgkgsikksfleel
    lttgggrftpeeiknmwaafppdvagnvdyknicyvithgedaege
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mysB (B:)
    fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
    vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
    fpvdyknicyvithgeda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2mysC (C:)
    efskaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemna
    aaitfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmte
    eeveelmkgqedsngcinyeafvkhimsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mysC (C:)
    aaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkiaaitfeeflpmlqaa
    annkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteeeveelmkgqedsng
    cinyeafvkhimsv