PDB entry 2myc

View 2myc on RCSB PDB site
Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-08-04, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myoglobin (n-butyl isocyanide)
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2myca_
  • Heterogens: SO4, HEM, NBN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mycA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg