PDB entry 2mya

View 2mya on RCSB PDB site
Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes
Deposited on 1993-08-04, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2mya__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mya_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg