PDB entry 2mwb

View 2mwb on RCSB PDB site
Description: FBP28 WW2 mutant W457F
Class: transcription
Keywords: melting, TRANSCRIPTION
Deposited on 2014-11-03, released 2014-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation regulator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA150, TAF2S, TCERG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14776 (Start-36)
      • conflict (29)
    Domains in SCOPe 2.07: d2mwba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mwbA (A:)
    gatavsewteyktadgktyyynnrtlestfekpqelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mwbA (A:)
    avsewteyktadgktyyynnrtlestfekpqelk