PDB entry 2mvz

View 2mvz on RCSB PDB site
Description: Solution Structure for Cyclophilin A from Geobacillus Kaustophilus
Class: isomerase
Keywords: Cyclophilin, Thermophile, PPIase, ISOMERASE
Deposited on 2014-10-20, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GK2298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mvza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mvzA (A:)
    gsmakkgyilmenggkiefelfpneapvtvanfeklanegfyngltfhrvipgfvsqggc
    prgngtgdagytipcetdnnphrhvtgamsmahrgrdtgscqffivhepqphldgvhtvf
    gqvtsgmdvvrtmkngdvmkevkvfdep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mvzA (A:)
    makkgyilmenggkiefelfpneapvtvanfeklanegfyngltfhrvipgfvsqggcpr
    gngtgdagytipcetdnnphrhvtgamsmahrgrdtgscqffivhepqphldgvhtvfgq
    vtsgmdvvrtmkngdvmkevkvfdep