PDB entry 2muc

View 2muc on RCSB PDB site
Description:
Deposited on 1998-10-26, released 1998-11-04
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2muca1, d2muca2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2mucb1, d2mucb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mucA (A:)
    mtsalieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglayg
    yespegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrl
    glpvsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlk
    hvvtikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnq
    rtpapimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglygg
    tmlegsigtlasahafltlrqltwgteligplllteeivneppqyrdfqlhiprtpglgl
    tldeqrlarfarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mucA (A:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgteligplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2mucB (B:)
    mtsalieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglayg
    yespegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrl
    glpvsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlk
    hvvtikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnq
    rtpapimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglygg
    tmlegsigtlasahafltlrqltwgteligplllteeivneppqyrdfqlhiprtpglgl
    tldeqrlarfarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mucB (B:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgteligplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar