PDB entry 2mtp

View 2mtp on RCSB PDB site
Description: The structure of Filamin repeat 21 bound to integrin
Class: PROTEIN BINDING/Cell Adhesion
Keywords: integrin, filamin, PROTEIN BINDING-Cell Adhesion complex
Deposited on 2014-08-28, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNA, FLN, FLN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mtpa_
  • Chain 'B':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2B, GP2B, ITGAB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB3, GP3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05106 (0-46)
      • engineered mutation (1-2)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtpA (A:)
    ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
    ayvvqepgdyevsvkfneehipdspfvvpvaspsg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.