PDB entry 2mti

View 2mti on RCSB PDB site
Description: NMR structure of the lymphocyte receptor NKR-P1A
Class: Immune system
Keywords: C-type lectin-like domain, NK cells, NK receptor, NKR-P1A, Immune system
Deposited on 2014-08-19, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1A
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Klrb1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mtia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtiA (A:)
    saklecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek
    ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw
    icqkelyhetlsnyvgygh