PDB entry 2mta

View 2mta on RCSB PDB site
Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Class: electron transport
Keywords: electron transport
Deposited on 1993-10-26, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2mtaa_
  • Chain 'C':
    Compound: cytochrome c551i
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2mtac_
  • Chain 'H':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (0-372)
      • conflict (298)
    Domains in SCOPe 2.05: d2mtah_
  • Chain 'L':
    Compound: methylamine dehydrogenase (light subunit)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (0-124)
      • conflict (50)
    Domains in SCOPe 2.05: d2mtal_
  • Heterogens: CU, PO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaC (C:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaH (H:)
    qgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrvig
    midggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdaprf
    lvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtff
    mhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihqid
    lssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasrfl
    vvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvnql
    ghgpqvittadmg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaL (L:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas