PDB entry 2mta

View 2mta on RCSB PDB site
Description:
Deposited on 1993-10-26, released 1994-01-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2mtaa_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2mtac_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2mtah_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2mtal_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaC (C:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaH (H:)
    qgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrvig
    midggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdaprf
    lvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtff
    mhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihqid
    lssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasrfl
    vvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvnql
    ghgpqvittadmg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mtaL (L:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas