PDB entry 2mt9

View 2mt9 on RCSB PDB site
Description: Solution structure of holo_FldB
Class: electron transport
Keywords: alpha/beta/alpha sandwich fold, ELECTRON TRANSPORT
Deposited on 2014-08-15, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavodoxin-2
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: fldB, b2895, JW2863
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mt9a_
  • Heterogens: FMN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mt9A (A:)
mnmglfygsstcytemaaekirdiigpelvtlhnlkddspklmeqydvlilgiptwdfge
iqedweavwdqlddlnlegkivalyglgdqlgygewfldalgmlhdklstkgvkfvgywp
tegyeftspkpviadgqlfvglaldetnqydlsderiqswceqilnemaehya