PDB entry 2msp

View 2msp on RCSB PDB site
Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5
Deposited on 1997-12-19, released 1998-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-15, with a file datestamp of 1998-04-15.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.22
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2mspa_
  • Chain 'B':
    Domains in SCOP 1.55: d2mspb_
  • Chain 'C':
    Domains in SCOP 1.55: d2mspc_
  • Chain 'D':
    Domains in SCOP 1.55: d2mspd_
  • Chain 'E':
    Domains in SCOP 1.55: d2mspe_
  • Chain 'F':
    Domains in SCOP 1.55: d2mspf_
  • Chain 'G':
    Domains in SCOP 1.55: d2mspg_
  • Chain 'H':
    Domains in SCOP 1.55: d2msph_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspA (A:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspB (B:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspC (C:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspD (D:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspE (E:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspF (F:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspG (G:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mspH (H:)
    svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
    dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl