PDB entry 2ms3

View 2ms3 on RCSB PDB site
Description: The NMR structure of the rubredoxin domain of the NO Reductase Flavorubredoxin from Escherichia coli
Class: electron transport
Keywords: rubredoxin, flavorubredoxin, nitric oxide reductase, nitric oxide, NorV, electron transport
Deposited on 2014-07-22, released 2015-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anaerobic nitric oxide reductase flavorubredoxin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: norV, flrD, ygaI, ygaJ, ygaK, b2710, JW2680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ms3a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ms3A (A:)
    gprmqcsvcqwiydpakgepmqdvapgtpwsevpdnflcpecslgkdvfeelaseak