PDB entry 2mrd

View 2mrd on RCSB PDB site
Description: Solution structure of human Ca2+-loaded S100A4 cys-free mutant
Class: metal binding protein
Keywords: S100A4, calcium-binding, METAL BINDING PROTEIN
Deposited on 2014-07-03, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26447 (0-100)
      • engineered mutation (2)
      • engineered mutation (75)
      • engineered mutation (80)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d2mrda_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26447 (0-100)
      • engineered mutation (2)
      • engineered mutation (75)
      • engineered mutation (80)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d2mrdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mrdA (A:)
    masplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeysvflssiammsneffegfpdkqprkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mrdB (B:)
    masplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeysvflssiammsneffegfpdkqprkk