PDB entry 2mrc

View 2mrc on RCSB PDB site
Description: NMR Structure and 1H, 13C and 15N Chemical Shift Assignments for High mobility group protein from Plasmodium falciparum 3D7.
Class: protein binding
Keywords: pathogenesis, virulence, PROTEIN BINDING, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2014-07-02, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high mobility group protein
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PfHMGB2, MAL8P1.72
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IB14 (9-91)
      • initiating methionine (0)
      • expression tag (1-8)
    Domains in SCOPe 2.08: d2mrca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mrcA (A:)
mahhhhhhmkkkdplapkralsaymfyvkdkrleiikekpelakdvaqvgkligeawgql
spaqkapyekkaqldkvryskeieeyrkknqe