PDB entry 2mr8

View 2mr8 on RCSB PDB site
Description: holo structure of the Peptidyl Carrier Protein Domain 7 of the teicoplanin producing Non-ribosomal peptide synthetase
Class: biosynthetic protein
Keywords: Non-ribosomal peptide synthetase, peptidyl carrier protein, BIOSYNTHETIC PROTEIN
Deposited on 2014-07-02, released 2015-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-ribosomal peptide synthetase
  Species: Actinoplanes teichomyceticus [TaxId:1867]
  Gene: tcp12
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q70AZ6 (3-80)
    • expression tag (0-2)
    • expression tag (81-90)
  Domains in SCOPe 2.08: d2mr8a1, d2mr8a2, d2mr8a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mr8A (A:)
  gamakapesatekvlcalyaeilgvervgvddafhdlggssalamrliarireelgvdlp
  irqlfssptpagvaralaaksaswshpqfek