PDB entry 2mqh

View 2mqh on RCSB PDB site
Description: Solution structure of the Chlamydomonas reinhardtii NAB1 cold shock domain, CSD1
Class: DNA binding protein
Keywords: protein, cold shock domain, RNA-binding, Chlamydomonas reinhardtii, algae, DNA BINDING PROTEIN
Deposited on 2014-06-20, released 2015-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleic acid binding protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CHLREDRAFT_126810, Nab1, NAB1 nucleic acid binding protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GV23 (12-81)
      • expression tag (10-11)
    Domains in SCOPe 2.05: d2mqha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mqhA (A:)
    mrgshhhhhhgsgeqlrqqgtvkwfnatkgfgfitpggggedlfvhqtninsegfrslre
    gevvefeveagpdgrskavnvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mqhA (A:)
    gsgeqlrqqgtvkwfnatkgfgfitpggggedlfvhqtninsegfrslregevvefevea
    gpdgrskavnvt