PDB entry 2mq3

View 2mq3 on RCSB PDB site
Description: NMR structure of the c3 domain of human cardiac myosin binding protein-c with a hypertrophic cardiomyopathy-related mutation R502W.
Class: contractile protein
Keywords: cardiac myosin binding protein C, C3 domain, Ig-like, hypertrophic cardiomyopathy, CONTRACTILE PROTEIN
Deposited on 2014-06-12, released 2014-07-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, cardiac-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14896 (4-94)
      • expression tag (0-3)
      • engineered mutation (53)
    Domains in SCOPe 2.08: d2mq3a1, d2mq3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mq3A (A:)
    gshmpvlitrpledqlvmvgqrvefecevseegaqvkwlkdgveltreetfkywfkkdgq
    rhhliineamledaghyalctsggqalaelivqek