PDB entry 2mps

View 2mps on RCSB PDB site
Description: Structure of complex of MDM2(3-109) and P73 TAD(10-25)
Class: ligase/peptide
Keywords: MDM2, P73 TAD, P53, LIGASE-PEPTIDE complex
Deposited on 2014-06-02, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mpsa_
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mpsA (A:)
    ntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyim
    tkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    No sequence available.