PDB entry 2mpc

View 2mpc on RCSB PDB site
Description: Solution structure of the pyrin domain of human Pyrin
Class: signaling protein
Keywords: pyrin domain, death domain, inflammation, CS-Rosetta, SIGNALING PROTEIN
Deposited on 2014-05-15, released 2014-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEFV, MEF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15553 (Start-91)
      • expression tag (92)
    Domains in SCOPe 2.05: d2mpca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2mpcA (A:)
maktpsdhllstleelvpydfekfkfklqntsvqkehsriprsqiqrarpvkmatllvty
ygeeyavqltlqvlrainqrllaeelhraaiqlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2mpcA (A:)
tpsdhllstleelvpydfekfkfklqntsvqkehsriprsqiqrarpvkmatllvtyyge
eyavqltlqvlrainqrllaeelhraaiql