PDB entry 2mpa

View 2mpa on RCSB PDB site
Description: bactericidal antibody against neisseria meningitidis
Class: immune system
Keywords: murine immunoglobulin igg2a kappa, bactericidal antibody, epitope p1.16 of pora from neisseria meningitidis, complex (immunoglobulin-peptide), immune system
Deposited on 1999-06-09, released 1999-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (mn12h2 igg2a-kappa)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB U60443 (0-120)
      • expression tag (120-123)
    • Uniprot P84751 (120-End)
    Domains in SCOPe 2.05: d2mpah1, d2mpah2
  • Chain 'L':
    Compound: protein (mn12h2 igg2a-kappa)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB U60442 (0-119)
      • see remark 999 (12)
      • expression tag (113)
    • Uniprot P01837 (7-105)
    Domains in SCOPe 2.05: d2mpal1, d2mpal2
  • Chain 'P':
    Compound: conjugate of pora p1.16 peptide with fluorescein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2MPA (0-8)
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2mpaH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mpaH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mpaL (L:)
    divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.