PDB entry 2mpa

View 2mpa on RCSB PDB site
Description: bactericidal antibody against neisseria meningitidis
Class: immune system
Keywords: murine immunoglobulin igg2a kappa, bactericidal antibody, epitope p1.16 of pora from neisseria meningitidis, complex (immunoglobulin/peptide)
Deposited on 1999-06-09, released 1999-06-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (mn12h2 igg2a-kappa)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB U60443 (0-120)
      • cloning artifact (120-123)
    • PIR S40295 (120-End)
    Domains in SCOP 1.75: d2mpah1, d2mpah2
  • Chain 'L':
    Compound: protein (mn12h2 igg2a-kappa)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB U60442 (0-119)
      • see remark 999 (12)
      • cloning artifact (113)
    • PIR PC4203 (120-218)
    Domains in SCOP 1.75: d2mpal1, d2mpal2
  • Chain 'P':
    Compound: conjugate of pora p1.16 peptide with fluorescein
    Species: synthetic, synthetic
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2mpaH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mpaH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mpaL (L:)
    divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.