PDB entry 2mp5

View 2mp5 on RCSB PDB site
Description: Structure of Bitistatin B
Class: toxin
Keywords: Bitis arietans, snake venom, disintegrin, TOXIN
Deposited on 2014-05-11, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain '1':
  Compound: Disintegrin bitistatin
  Species: Bitis arietans [TaxId:8692]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17497 (0-82)
  Domains in SCOPe 2.07: d2mp51_

PDB Chain Sequences:

• Chain '1':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mp51 (1:)
  sppvcgnkileqgedcdcgspancqdrccnaatckltpgsqcnygeccdqcrfkkagtvc
  riargdwnddyctgkssdcpwnh