PDB entry 2mo1

View 2mo1 on RCSB PDB site
Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for cold shock protein, TaCsp with dT7
Class: DNA binding protein
Keywords: cold shock protein, thermus aquaticus, protein stability, protein binding, DNA BINDING PROTEIN
Deposited on 2014-04-17, released 2014-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold-shock DNA-binding domain protein
    Species: Thermus aquaticus [TaxId:498848]
    Gene: TaqDRAFT_4615
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mo1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mo1A (A:)
mkkgtvkwfnaekgygfiqqeegpdvfvhftaieadgfrtlnegehvefevepgrggkgp
qakkvrri