PDB entry 2mo0

View 2mo0 on RCSB PDB site
Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for cold shock protein, TaCsp
Class: DNA binding protein
Keywords: cold shock protein, thermus aquaticus, protein binding, protein stability, DNA BINDING PROTEIN
Deposited on 2014-04-17, released 2014-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold-shock DNA-binding domain protein
    Species: Thermus aquaticus [TaxId:498848]
    Gene: TaqDRAFT_4615
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mo0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mo0A (A:)
mkkgtvkwfnaekgygfiqqeegpdvfvhftaieadgfrtlnegehvefevepgrggkgp
qakkvrri