PDB entry 2mng

View 2mng on RCSB PDB site
Description: Apo Structure of human HCN4 CNBD solved by NMR
Class: transport protein
Keywords: Cyclic AMP binding domain, CS-ROSETTA, TRANSPORT PROTEIN
Deposited on 2014-04-03, released 2014-06-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3Q4 (2-130)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2mnga1, d2mnga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mngA (A:)
nseeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiq
hgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleey
pmmrrafetva