PDB entry 2mmx

View 2mmx on RCSB PDB site
Description: NMR study of 6aJL2
Class: immune system
Keywords: light chain, amyloidosis, systemic, lambda, IMMUNE SYSTEM
Deposited on 2014-03-20, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: V1-22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
      • expression tag (98-110)
    Domains in SCOPe 2.08: d2mmxa1, d2mmxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mmxA (A:)
    nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl