PDB entry 2mmn

View 2mmn on RCSB PDB site
Description: Solution Structure of the Reduced Thioredoxin from Plasmodium falciparum
Class: electron transport
Keywords: Plasmodium falciparum, Thioredoxin, ELECTRON TRANSPORT
Deposited on 2014-03-16, released 2015-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQL8 (1-103)
      • expression tag (0)
      • conflict (8)
    Domains in SCOPe 2.08: d2mmna1, d2mmna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mmnA (A:)
svkivtsqsefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdev
sevtekenitsmptfkvykngssvdtllgandsalkqliekyaa