PDB entry 2mm1

View 2mm1 on RCSB PDB site
Description: x-ray crystal structure of a recombinant human myoglobin mutant at 2.8 angstroms resolution
Deposited on 1991-02-19, released 1993-01-15
The last revision prior to the SCOP 1.57 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.158
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2mm1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mm1_ (-)
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykelgfqg