PDB entry 2mm1

View 2mm1 on RCSB PDB site
Description: x-ray crystal structure of a recombinant human myoglobin mutant at 2.8 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-02-19, released 1993-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.158
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02144 (0-152)
      • conflict (44)
      • conflict (109)
    Domains in SCOPe 2.07: d2mm1a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mm1A (A:)
    glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
    lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamnkalelfrkdmasnykelgfqg