PDB entry 2mls

View 2mls on RCSB PDB site
Description: Membrane Bilayer complex with Matrix Metalloproteinase-12 at its Beta-face
Class: hydrolase
Keywords: Membrane-binding of soluble metalloproteinase MMP-12, Catalytic domain, HYDROLASE
Deposited on 2014-03-04, released 2014-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-163)
      • engineered mutation (119)
    Domains in SCOPe 2.08: d2mlsa_
  • Heterogens: ZN, CA, PX4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mlsA (A:)
    frempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadi
    lvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavha
    ighslglghssdpkavmfptykyvdintfrlsaddirgiqslyg