PDB entry 2mlm

View 2mlm on RCSB PDB site
Description: Solution structure of sortase A from S. aureus in complex with benzo[d]isothiazol-3-one based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE/HYDROLASE INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-03-03, released 2014-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sortase family protein
    Species: Staphylococcus aureus [TaxId:1323661]
    Gene: CA347_2602
    Database cross-references and differences (RAF-indexed):
    • Uniprot R9YTM5 (1-147)
      • expression tag (0)
    Domains in SCOPe 2.08: d2mlma1, d2mlma2
  • Heterogens: 2W7

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mlmA (A:)
    mqakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisia
    ghtfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvevldeqkgkdkq
    ltlitcddynektgvwekrkifvatevk