PDB entry 2mla

View 2mla on RCSB PDB site
Description: Solution structure of BmKTX-D19K
Class: toxin
Keywords: toxin
Deposited on 2014-02-21, released 2015-02-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 3.6
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NII7 (0-36)
      • engineered mutation (18)
    Domains in SCOPe 2.05: d2mlaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mlaA (A:)
    vginvkckhsgqclkpckkagmrfgkcingkcdctpk