PDB entry 2mkr

View 2mkr on RCSB PDB site
Description: Structural Characterization of a Complex Between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 subunit of TFIIH.
Class: viral protein/transcription
Keywords: EBV, EBNA2, TFIIH, TFB1, ACTIVATION, TRANSCRIPTION, PH DOMAIN, VIRAL PROTEIN-TRANSCRIPTION complex
Deposited on 2014-02-12, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: D9740.3, TFB1, YDR311W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (0-114)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2mkra_
  • Chain 'B':
    Compound: Epstein-Barr nuclear antigen 2
    Species: Human herpesvirus 4 [TaxId:10377]
    Gene: BYRF1, EBNA2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mkrA (A:)
    pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
    rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad
    

  • Chain 'B':
    No sequence available.