PDB entry 2mj0

View 2mj0 on RCSB PDB site
Description: Spatial structure of P33A mutant of non-conventional toxin WTX from Naja kaouthia
Class: Toxin
Keywords: WTX, weak toxin, muscarinic acetylcholine receptors, nicotonic acetylcholine receptors, non-conventional toxin, Toxin
Deposited on 2013-12-23, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Weak tryptophan-containing neurotoxin
    Species: Naja kaouthia [TaxId:8649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82935 (1-65)
      • expression tag (0)
      • engineered mutation (33)
    Domains in SCOPe 2.07: d2mj0a1, d2mj0a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mj0A (A:)
mltclncpemfcgkfqicrngekicfkklhqrralswryirgcadtcpvgkpyemieccs
tdkcnr