PDB entry 2mio

View 2mio on RCSB PDB site
Description: Solution NMR Structure of SH3 Domain 1 of Rho GTPase-activating Protein 10 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9129A
Class: Structural genomics, Unknown function
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, Unknown function
Deposited on 2013-12-16, released 2014-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho GTPase-activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGAP10, GRAF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1A4S6 (11-69)
      • expression tag (0-10)
    Domains in SCOPe 2.06: d2mioa1, d2mioa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mioA (A:)
    mghhhhhhshmirsrkaravypceaehsselsfeigaifedvqtsrepgwlegtlngkrg
    lipqnyvkll