PDB entry 2mic

View 2mic on RCSB PDB site
Description: nmr structure of p75 transmembrane domain in dpc micelles
Deposited on 2013-12-12, released 2014-12-24
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 16
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ngfr, Tnfrsf16
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07174
      • initiating methionine (0)
      • engineered mutation (35)
  • Chain 'B':
    Compound: Tumor necrosis factor receptor superfamily member 16
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ngfr, Tnfrsf16
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07174 (1-40)
      • initiating methionine (0)
      • engineered mutation (35)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2micA (A:)
    mtrgttdnlipvycsilaavvvglvayiafkrwnsskqnkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2micB (B:)
    mtrgttdnlipvycsilaavvvglvayiafkrwnsskqnkq