PDB entry 2mhn

View 2mhn on RCSB PDB site
Description: NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
Class: transcription
Keywords: T-Cell, PSI-Biology, RNA binding protein, TRANSCRIPTION
Deposited on 2013-12-02, released 2014-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 39
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM39, HCC1, RNPC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14498 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2mhna1, d2mhna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhnA (A:)
    ghmnltpeerdartvfcmqlaarirprdleeffstvgkvrdvrmisdrnsrrskgiayve
    fvdvssvplaigltgqrvlgvpiivqasqaeknr