PDB entry 2mhm

View 2mhm on RCSB PDB site
Description: Solution structure of cytochrome c Y67H
Class: electron transport
Keywords: Y67H, hydrogen-bond, H2O2, guaiacol, peroxidation, ELECTRON TRANSPORT
Deposited on 2013-11-26, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CYC1, J1653, YJR048W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered mutation (71)
    • conflict (76)
    • conflict (106)
  Domains in SCOPe 2.07: d2mhma_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mhmA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmsehltnpakyipgtkmafgglkkekdrndlitylkkate