PDB entry 2mha

View 2mha on RCSB PDB site
Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
Deposited on 1993-07-21, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaC (C:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaD (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm