PDB entry 2mha

View 2mha on RCSB PDB site
Description:
Deposited on 1993-07-21, released 1993-10-31
The last revision prior to the SCOP 1.65 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2mhaa1, d2mhaa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2mhab_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2mhac1, d2mhac2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2mhad_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaC (C:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mhaD (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm