PDB entry 2mh8

View 2mh8 on RCSB PDB site
Description: GA-79-MBP cs-rosetta structures
Class: protein binding
Keywords: MBP, maltose binding protein, GA, human serum albumin binding protein, PROTEIN BINDING
Deposited on 2013-11-19, released 2015-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GA-79-MBP, maltose binding protein
    Species: STREPTOCOCCUS DYSGALACTIAE [TaxId:1334]
    Database cross-references and differences (RAF-indexed):
    • PDB 2MH8 (0-55)
    Domains in SCOPe 2.08: d2mh8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mh8A (A:)
    ngdkgynglaeakekaikdlkiygigehyikliekakqvaavedlkdeilkahdrf