PDB entry 2mh0

View 2mh0 on RCSB PDB site
Description: Solution NMR structure of the p300 Taz2:ETAD1 complex
Class: transcription/transferase
Keywords: TRANSCRIPTION-TRANSFERASE complex
Deposited on 2013-11-12, released 2014-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor E2-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TCF3, BHLHB21, E2A, ITF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15923 (2-38)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (2-91)
      • expression tag (0-1)
      • engineered mutation (17)
      • engineered mutation (25)
      • engineered mutation (68-69)
    Domains in SCOPe 2.08: d2mh0b1, d2mh0b2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mh0B (B:)
gsatqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcp
ickqlialaayhakhcqenkcpvpfclnikqk