PDB entry 2mgw

View 2mgw on RCSB PDB site
Description: Solution Structure of the UBA Domain of Human NBR1
Class: protein binding
Keywords: autophagy, protein degradation, ubiquitin binding, PROTEIN BINDING
Deposited on 2013-11-09, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Next to BRCA1 gene 1 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: NBR1, 1A13B, KIAA0049, M17S2, MIG19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14596 (5-51)
    • expression tag (0-4)
  Domains in SCOPe 2.06: d2mgwa1, d2mgwa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mgwA (A:)
  gplgssedqtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellqlnnn